PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID snap_masked-scaffold26818-abinit-gene-0.1-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 167aa    MW: 18860.5 Da    PI: 9.009
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
snap_masked-scaffold26818-abinit-gene-0.1-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.42.4e-38101091100
                                            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamssl 61 
                                                       aC++Ck++r+kC ++C lapyfpa++ ++f+n+hklFG+sn+lk+++a++ ++r+++++s+
  snap_masked-scaffold26818-abinit-gene-0.1-mRNA-1  10 ACSSCKHQRKKCDQNCELAPYFPASRYHEFQNAHKLFGVSNILKIMNAVELSQRQATAESI 70 
                                                       7************************************************************ PP

                                            DUF260  62 vyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                                       ++e++ar +dPv+G++g+i++l++q+e  +++l+ ++++
  snap_masked-scaffold26818-abinit-gene-0.1-mRNA-1  71 LMEGNARRSDPVNGCLGIISNLKSQVEFYEKQLNIVNQH 109
                                                       **********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.8319110IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-3510107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MNREGGNPSA CSSCKHQRKK CDQNCELAPY FPASRYHEFQ NAHKLFGVSN ILKIMNAVEL  60
SQRQATAESI LMEGNARRSD PVNGCLGIIS NLKSQVEFYE KQLNIVNQHL AIYRGREKLE  120
RQNQKLEDSA NISSFASKPP LAPTPVQHNQ IDEFKLLSPI LPNLVRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889088.16e-59PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A067E2B94e-54A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-37LOB domain-containing protein 22